Who wants domestic hcg? Here you go guy

[Joeblack]

www.proratesupplements.com

I knew they were opening for a few weeks now. I got some hcg and eca from them. Tested the Hcg and its good and eca is good also.

Enjoy everyone

ps no this is not my site and i dont have anything to do with it.

 

[TheOracle]

That ECA is not what you want. You do not want Ephedra you want Ephedrine HCL or Sulfate

 

[Johnb49e]

www.proratesupplements.com

I knew they were opening for a few weeks now. I got some hcg and eca from them. Tested the Hcg and its good and eca is good also.

Enjoy everyone

ps no this is not my site and i dont have anything to do with it.

Nice find. I think I'll stick to pharmacist for the hcg but I'm curious to know how legit the igf of theirs is?

 

[Joeblack]

Ill know a little better about the IGF today once i take a shot. I use a lot of peptides and tons of igf. I know what to see from it and feel

 

[Johnb49e]

Sounds good man, keep us updated!

 

[fastasf]

They have 4 products?

 

[Gobuckeyes0122]

They have 4 products?

I noticed that too. Makes me wonder...

 

[ThE SiCkNeSs]

That ECA is not what you want. You do not want Ephedra you want Ephedrine HCL or Sulfate

A lot of places are starting to sell ephedra again. My local gas station sell an energy shot called rhino rush. Says it has 25 mgs ephedra in it, so I bought one. Didn't feel shit. I looked into it and it is ephedra with-out the alkaloids that actually work. That's how they legally sell it. Probably what this shit is.

 

[Joeblack]

Yes they only have 4 products. They are in the start up faze.

IGF post workout feedback. Good pumps and took more than i should to see if i would feel the blood sugar drop. I did. From what i can tell from using igf a million times. Its legit. Im going to try to get us a discount code for meso. Im going to buy some more igf for my workout partner and his friend.

I was nice enough to post his site. He should be nice enough to give us a deal. Ill keep everyone posted.

Ill post a pic of the vials soon. Nothing special look wise but who cares about that. I never do

 

[heady muscle]

www.proratesupplements.com

I knew they were opening for a few weeks now. I got some hcg and eca from them. Tested the Hcg and its good and eca is good also.

Enjoy everyone

ps no this is not my site and i dont have anything to do with it.

Nice looking out and sharing!

 

[Joeblack]

Here you go people! Emailed them. Share this link and got a code

discount code is " Meso " 10% off

 

[Joeblack]

Used it again this workout. Very happy so far

 

[Pocket_Herculese]

How effective does their hcg seem to be if you've already used it?

 

[Joeblack]

How effective does their hcg seem to be if you've already used it?

i am using it. Seems like all other legit hcg ive used. I did the prego test on it. Legit

 

[Pocket_Herculese]

Nice, it'd be great not having to sign for so many packages, I might have to check these guys out

 

[SicilianKiss]

Real IGF1 costs in the neighborhood of $450+ for 1mg. That stuff they have listed, Ill bet money isnt real. Not to mention, IGF1 has to be shipped cold and stored cold. Once reconstituted has to be used within 48hours or it goes bad. It amazes me that people fall for these fakes so easily.

 

[Joeblack]

That is not true about IGF 1- Lr3. I know this because when SRCS was testing things like this. I used to get peptide companies IGF tested. This was back from 2005 to 2010. Now IGF isnt cheap and some of the peptide companies selling it BOGO and you get it for like $30 is iffy at best.

 

[SicilianKiss]

That is not true about IGF 1- Lr3. I know this because when SRCS was testing things like this. I used to get peptide companies IGF tested. This was back from 2005 to 2010. Now IGF isnt cheap and some of the peptide companies selling it BOGO and you get it for like $30 is iffy at best.

Bullshit. You obviously are experiencing a placebo effect. Real IGF1 is expensive. No way you are getting real deal from that website, or any website thats selling it for $60, $70, $80, or $100 per 1mg.

If you used to get IGF1 tested, post up the SRCS results, I want to see them. Thanks!

 

[SicilianKiss]

Bullshit. You obviously are experiencing a placebo effect. Real IGF1 is expensive. No way you are getting real deal from that website, or any website thats selling it for $60, $70, $80, or $100 per 1mg.

If you used to get IGF1 tested, post up the SRCS results, I want to see them. Thanks!

And if you think your IGF1 is real, post up before and after pics. I want to see this awesome transformation you're experiencing.

 

[Joeblack]

Bullshit. You obviously are experiencing a placebo effect. Real IGF1 is expensive. No way you are getting real deal from that website, or any website thats selling it for $60, $70, $80, or $100 per 1mg.

If you used to get IGF1 tested, post up the SRCS results, I want to see them. Thanks!

Ill see if i can find them. Ive been though a few computers since that time. And why would I lie? I have nothing to do with this company or any other. Why would i defend some peoples IGF. Yes there are a ton of fakes out there. Do you know of any peptide companies in the USA? Have you ever talked to them and seen there labs? Guess what I HAVE. I live 45 minutes from a legit, doesnt sell to the public Peptide company. And another USA company out of Massachusetts.

so Yes IGF can be real for selling price of about $60 will it all have an Amino Acid Sequence of:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV
DECCFRSCDLRRLEMYCAPLKPAKSA good chance not. Are there some legit companies. YES